Antibodies

Jump to Filters
View as table Download
PDPN Hamster Monoclonal Antibody [Clone ID: 8.1.1]
TA336668

USD 457.00

5 Days

Golden Syrian Hamster Monoclonal Podoplanin Antibody (8.1.1)

Applications FC, IHC, WB
Reactivities Mouse (Does not react with: Human)
Conjugation Unconjugated
PDPN Goat Polyclonal Antibody
TA305702

USD 375.00

5 Days

Goat Anti-PDPN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EKVDGDTQTTVEKD, from the internal region of the protein sequence according to NP_006465.3; NP_938203.2; NP_001006625.1; NP_001006626.1.
PDPN Rabbit Polyclonal Antibody
TA335682

USD 375.00

5 Days

Rabbit Polyclonal Anti-PDPN Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PDPN Antibody: synthetic peptide directed towards the N terminal of human PDPN. Synthetic peptide located within the following region: EGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVAT
PDPN Rabbit Polyclonal Antibody
TA335683

USD 375.00

5 Days

Rabbit Polyclonal Anti-PDPN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PDPN Antibody: synthetic peptide directed towards the middle region of human PDPN. Synthetic peptide located within the following region: VATSHSTEKVDGDTQTTVEKDGLSTVTLVGIIVGVLLAIGFIGAIIVVVM
PDPN Rabbit Polyclonal Antibody
TA351946

USD 345.00

In Stock

Rabbit Polyclonal Anti-PDPN Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human PDPN