Germany
Japan
United Kingdom
China
Rabbit anti-RBP4 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant Protein of human RBP4 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-RBP4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RBP4 antibody: synthetic peptide directed towards the N terminal of human RBP4. Synthetic peptide located within the following region: MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDP |
Goat Polyclonal Antibody against RBP4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QKGNDDHWIVDTDYD, from the internal region of the protein sequence according to NP_006735.2. |
Goat Polyclonal Antibody against RBP4 (Internal)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DTEDPAKFKMKY, from the internal region of the protein sequence according to NP_006735.2. |
Rabbit Polyclonal Anti-RBP4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RBP4 |
Active filters
Target Symbol
- RBP4
Isotypes
- IgG
Families
- Druggable Genome