Rabbit Polyclonal Anti-REEP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-REEP1 antibody: synthetic peptide directed towards the middle region of human REEP1. Synthetic peptide located within the following region: AKDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTI |
Rabbit Polyclonal Anti-REEP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-REEP1 antibody: synthetic peptide directed towards the C terminal of human REEP1. Synthetic peptide located within the following region: ERLRSFSMQDLTTIRGDGAPAPSGPPPPGSGRASGKHGQPKMSRSASESA |
Germany
Japan
United Kingdom
China
