Antibodies

View as table Download

Rabbit polyclonal antibody to SIGLEC9 (sialic acid binding Ig-like lectin 9)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 273 of SIGLEC9 (Uniprot ID#Q9Y336)

Rabbit Polyclonal Anti-SIGLEC9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SIGLEC9 antibody: synthetic peptide directed towards the C terminal of human SIGLEC9. Synthetic peptide located within the following region: PWVHLRDAAEFTCRAQNPLGSQQVYLNVSLQSKATSGVTQGVVGGAGATA

Rabbit Polyclonal Anti-SIGLEC9 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human SIGLEC9