Antibodies

Jump to Filters
View as table Download
CKMT2 Rabbit Polyclonal Antibody
TA346081

USD 410.00

5 Days

Rabbit Polyclonal Anti-CKMT2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CKMT2 antibody: synthetic peptide directed towards the N terminal of human CKMT2. Synthetic peptide located within the following region: GTSVLTTGYLLNRQKVCAEVREQPRLFPPSADYPDLRKHNNCMAECLTPA
CKMT2 Rabbit Polyclonal Antibody
TA346082

USD 475.00

5 Days

Rabbit Polyclonal Anti-CKMT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CKMT2 antibody: synthetic peptide directed towards the C terminal of human CKMT2. Synthetic peptide located within the following region: ISNIDRIGRSEVELVQIVIDGVNYLVDCEKKLERGQDIKVPPPLPQFGKK
CKMT2 Rabbit Polyclonal Antibody
AP20412PU-N

USD 370.00

2 Weeks

CKMT2 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
CKMT2 Rabbit Polyclonal Antibody
TA313626

USD 345.00

4 Weeks

Rabbit polyclonal anti-CKMT2 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CKMT2.
CKMT2 Mouse Monoclonal Antibody [Clone ID: 3F4-G5-H5]
TA346920

USD 380.00

4 Weeks

Mouse Monoclonal CKMT2 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
CKMT2 Rabbit Polyclonal Antibody
TA349810

USD 345.00

In Stock

Rabbit Polyclonal Anti-CKMT2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CKMT2