Antibodies

Jump to Filters
View as table Download
UNC5C Goat Polyclonal Antibody
TA305907

USD 375.00

In Stock

Goat Anti-UNC5C Antibody

Applications IF
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence NCTVSEEPTGID, from the internal region of the protein sequence according to NP_003719.2.
UNC5C (Center) Rabbit Polyclonal Antibody
AP17822PU-N

USD 450.00

2 Weeks

UNC5C (Center) rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the Center region of human UNC5C
UNC5C Rabbit Polyclonal Antibody
TA338214

USD 375.00

5 Days

Rabbit Polyclonal Anti-UNC5C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UNC5C antibody is: synthetic peptide directed towards the middle region of Human UNC5C. Synthetic peptide located within the following region: EVSIEISRQQVEELFGPEDYWCQCVAWSSAGTTKSRKAYVRIAYLRKTFE
UNC5C Rabbit Polyclonal Antibody
TA338215

USD 375.00

5 Days

Rabbit Polyclonal Anti-UNC5C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UNC5C antibody: synthetic peptide directed towards the middle region of human UNC5C. Synthetic peptide located within the following region: VVVALFVYRKNHRDFESDIIDSSALNGGFQPVNIKAARQDLLAVPPDLTS
UNC5C Rabbit Polyclonal Antibody
TA338216

USD 375.00

5 Days

Rabbit Polyclonal Anti-UNC5C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UNC5C antibody: synthetic peptide directed towards the C terminal of human UNC5C. Synthetic peptide located within the following region: WRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQNFPDGNLSMLAAVLEE