Antibodies

View as table Download

INPP5B (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 957-987 amino acids from the C-terminal region of Human INPP5B / 5PTase 2.

Rabbit Polyclonal antibody to INPP5B (inositol polyphosphate-5-phosphatase, 75kDa)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 699 and 949 of INPP5B (Uniprot ID#P32019)

Rabbit Polyclonal Anti-INPP5B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-INPP5B antibody: synthetic peptide directed towards the middle region of human INPP5B. Synthetic peptide located within the following region: IHNGQVPCHFEFINKPDEESYCKQWLNANPSRGFLLPDSDVEIDLELFVN