Antibodies

Jump to Filters
View as table Download
NALP1 (NLRP1) Rabbit Polyclonal Antibody
TA306106

USD 430.00

5 Days

Rabbit Polyclonal NALP1 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen NALP1 antibody was raised against a peptide corresponding to 13 amino acids near the carboxy-terminus of human NALP1.
NALP1 (NLRP1) Rabbit Polyclonal Antibody
TA334965

USD 375.00

5 Days

Rabbit Polyclonal Anti-NLRP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NLRP1 antibody: synthetic peptide directed towards the N terminal of human NLRP1. Synthetic peptide located within the following region: DTQEPRIVILQGAAGIGKSTLARQVKEAWGRGQLYGDRFQHVFYFSCREL