FBXO4 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 231~260 amino acids from the Center region of human FBXO4 |
FBXO4 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 231~260 amino acids from the Center region of human FBXO4 |
Goat Anti-FBXO4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-PTAGLPQRQIDG, from the internal region of the protein sequence according to NP_036308.1; NP_277019.1. |
Rabbit Polyclonal Anti-FBXO4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FBXO4 antibody: synthetic peptide directed towards the middle region of human FBXO4. Synthetic peptide located within the following region: TSAVNKMFSRHNEGDDQQGSRYSVIPQIQKVCEVVDGFIYVANAEAHKSK |
Rabbit Polyclonal Anti-FBXO4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FBXO4 antibody: synthetic peptide directed towards the middle region of human FBXO4. Synthetic peptide located within the following region: KRMPCFYLAHELHLNLLNHPWLVQDTEAETLTGFLNGIEWILEEVESKRA |