Rabbit polyclonal Cytochrome P450 2R1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2R1. |
Rabbit polyclonal Cytochrome P450 2R1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2R1. |
Mouse monoclonal Anti-Cytochrome P450 2R1 Clone M26P6H1
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CYP2R1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP2R1 antibody: synthetic peptide directed towards the middle region of human CYP2R1. Synthetic peptide located within the following region: FKQLITNAVSNITNLIIFGERFTYEDTDFQHMIELFSENVELAASASVFL |
Rabbit Polyclonal Anti-CYP2R1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CYP2R1 antibody is: synthetic peptide directed towards the C-terminal region of Human CYP2R1. Synthetic peptide located within the following region: ALVPFSLGRRHCLGEHLARMEMFLFFTALLQRFHLHFPHELVPDLKPRLG |