Antibodies

View as table Download

USD 300.00

In Stock

Goat Polyclonal Anti-Rab1 Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptides derived from within residues 110 aa to the C-terminus of mouse Rab1a and Rab1b produced in E. coli.

Rabbit polyclonal Anti-RAB1A Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-RAB1A antibody: synthetic peptide directed towards the middle region of human RAB1A. Synthetic peptide located within the following region: AKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGC