Antibodies

View as table Download

Rabbit polyclonal Cyclin H (Ab-315) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Cyclin H around the phosphorylation site of threonine 315 (E-W-TP-D-D).

Rabbit Polyclonal Anti-Cyclin H Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Cyclin H Antibody: A synthesized peptide derived from human Cyclin H

Rabbit polyclonal Cyclin H (Thr315) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Cyclin H around the phosphorylation site of threonine 315 (E-W-TP-D-D)
Modifications Phospho-specific

Rabbit Polyclonal anti-CCNH antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CCNH antibody: synthetic peptide directed towards the N terminal of human CCNH. Synthetic peptide located within the following region: PHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEY