Rabbit polyclonal anti-DECR2 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DECR2. |
Rabbit polyclonal anti-DECR2 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DECR2. |
Rabbit Polyclonal Anti-Decr2 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Decr2 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PIPRLGTKTEIAHSVLYLASPLASYVSGIVLVVDGGSWMTFPNGIKQLLE |