Antibodies

Jump to Filters
View as table Download
MSX2 Rabbit Polyclonal Antibody
TA314214

USD 345.00

In Stock

Rabbit polyclonal anti-MSX2 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human MSX2.
MSX2 Rabbit Polyclonal Antibody
TA329263

USD 375.00

5 Days

Rabbit Polyclonal anti-MSX2 antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-MSX2 antibody: synthetic peptide directed towards the n terminal of human MSX2. Synthetic peptide located within the following region: MASPSKGNDLFSPDEEGPAVVAGPGPGPGGAEGAAEERRVKVSSLPFSVE