Antibodies

Jump to Filters
View as table Download
SMN1 Rabbit Polyclonal Antibody
TA345684

USD 475.00

5 Days

Rabbit Polyclonal Anti-SMN1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SMN1 antibody: synthetic peptide directed towards the N terminal of human SMN1. Synthetic peptide located within the following region: KAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKV
SMN1 Mouse Monoclonal Antibody [Clone ID: 2B1]
TA336277

USD 479.00

5 Days

Mouse Monoclonal SMN Antibody (2B1)

Applications IHC, WB
Reactivities Human, Mouse, Rat, Primate, Xenopus
Conjugation Unconjugated