Antibodies

Jump to Filters
View as table Download
Wilms Tumor Protein (WT1) Rabbit Polyclonal Antibody
TA326990

USD 275.00

3 Weeks

WT1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human WT1
Wilms Tumor Protein (WT1) Rabbit Polyclonal Antibody
TA335174

USD 375.00

In Stock

Rabbit Polyclonal Anti-WT1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-WT1 antibody: synthetic peptide directed towards the middle region of human WT1. Synthetic peptide located within the following region: DHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQLA