Antibodies

View as table Download

Goat Polyclonal Anti-CHRNA7 Antibody

Reactivities Rat (Expected from sequence similarity: Human, Mouse, Dog, Cow)
Conjugation Unconjugated
Immunogen The immunogen for Anti-CHRNA7 Antibody: Peptide with sequence KRPGEDKVRPACQHKQ, from the internal region of the protein sequence according to NP_000737.1.

Rabbit Polyclonal Anti-CHRNA7 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-CHRNA7 antibody: synthetic peptide directed towards the N terminal of human CHRNA7. Synthetic peptide located within the following region: QGEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQV