Rabbit Polyclonal antibody to EMR1 (egf-like module containing, mucin-like, hormone receptor-like 1)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 626 and 886 of EMR1 (Uniprot ID#Q14246) |
Rabbit polyclonal anti-EMR1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human EMR1. |
Rabbit Polyclonal Anti-EMR1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EMR1 antibody is: synthetic peptide directed towards the C-terminal region of Human EMR1. Synthetic peptide located within the following region: GAFIFLIHCLLNGQVREEYKRWITGKTKPSSQSQTSRILLSSMPSASKTG |
Rabbit Polyclonal Anti-EMR1 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | EMR1 / F4/80 antibody was raised against synthetic 18 amino acid peptide from C-terminus of human EMR1. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Marmoset (89%); Gibbon (83%). |
Germany
Japan
United Kingdom
China
