Antibodies

Jump to Filters
View as table Download
BRAP Rabbit Polyclonal Antibody
TA329802

USD 375.00

5 Days

Rabbit Polyclonal Anti-BRAP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BRAP antibody: synthetic peptide directed towards the middle region of human BRAP. Synthetic peptide located within the following region: YLETQQKINHLPAETRQEIQEGQINIAMASASSPASSGGSGKLPSRKGRS
BRAP Mouse Monoclonal Antibody [Clone ID: 1E7-C9-D10-B10]
TA346897

USD 380.00

4 Weeks

Mouse Monoclonal BRAP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
BRAP Mouse Monoclonal Antibody [Clone ID: 1E7-C9-D10-B10]
TA346897S

USD 85.00

4 Weeks

Mouse Monoclonal BRAP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated