Antibodies

View as table Download

Cyclin T1 (CCNT1) (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 256-285 amino acids from the Central region of human CCNT1

Rabbit Polyclonal CCNT1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rabbit polyclonal CCNT1 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human CCNT1.

Rabbit Polyclonal Anti-CCNT1 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CCNT1

Rabbit polyclonal Cyclin T1 antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Cyclin T1 peptide corresponding to an internal region of the human protein conjugated to Keyhole Limpet Hemocyanin (KLH).

Rabbit Polyclonal Anti-CCNT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CCNT1 antibody: synthetic peptide directed towards the N terminal of human CCNT1. Synthetic peptide located within the following region: EGERKNNNKRWYFTREQLENSPSRRFGVDPDKELSYRQQAANLLQDMGQR