Antibodies

Jump to Filters
View as table Download
CELA1 Mouse Monoclonal Antibody [Clone ID: 4H5]
AM31695PU-N

USD 480.00

2 Weeks

CELA1 mouse monoclonal antibody, clone 4H5, Purified

Applications ELISA, IHC, WB
Reactivities Human
CELA1 Rabbit Polyclonal Antibody
TA340038

USD 375.00

5 Days

Rabbit Polyclonal Anti-ELA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ELA1 antibody: synthetic peptide directed towards the N terminal of human ELA1. Synthetic peptide located within the following region: LVLYGHSTQDLPETNARVVGGTEAGRNSWPSQISLQYRSGGSRYHTCGGT