Antibodies

Jump to Filters
View as table Download
DUSP14 Rabbit Polyclonal Antibody
TA349311

USD 380.00

In Stock

Rabbit Polyclonal Anti-DUSP14 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human DUSP14
DUSP14 Rabbit Polyclonal Antibody
TA338118

USD 375.00

5 Days

Rabbit Polyclonal Anti-DUSP14 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DUSP14 antibody is: synthetic peptide directed towards the C-terminal region of Human DUSP14. Synthetic peptide located within the following region: PVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRHLMPY