Antibodies

View as table Download

Rabbit Polyclonal Anti-FBXW4 Antibody - C-terminal region

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Fbxw4 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: STFYCLQTDGNHLLATGSSYYGLVRLWDRRQRACLHAFPLTSTPLSSPVY

Rabbit Polyclonal Anti-FBXW4 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FBXW4 antibody is: synthetic peptide directed towards the N-terminal region of Human FBXW4. Synthetic peptide located within the following region: RQMPWMQLEDDSLYISQANFILAYQFRPDGASLNRRPLGVFAGHDEDVCH