Antibodies

Jump to Filters
View as table Download
GSDME (N-term) Rabbit Polyclonal Antibody
AP17278PU-N

USD 450.00

2 Weeks

GSDME (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 59-87 amino acids selected from the N-terminal region of human DFNA5
GSDME Rabbit Polyclonal Antibody
TA339270

USD 310.00

5 Days

Rabbit Polyclonal Anti-DFNA5 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DFNA5 antibody: synthetic peptide directed towards the C terminal of human DFNA5. Synthetic peptide located within the following region: AALLGTCCKLQIIPTLCHLLRALSDDGVSDLEDPTLTPLKDTERFGIVQR