Antibodies

Jump to Filters
View as table Download
LIMS1 Rabbit Polyclonal Antibody
TA343353

USD 375.00

5 Days

Rabbit Polyclonal Anti-LIMS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LIMS1 antibody is: synthetic peptide directed towards the middle region of Human LIMS1. Synthetic peptide located within the following region: HLCRPCHNREKARGLGKYICQKCHAIIDEQPLIFKNDPYHPDHFNCANCG
LIMS1 Rabbit Polyclonal Antibody
TA350137

USD 345.00

In Stock

Rabbit Polyclonal Anti-LIMS1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human LIMS1
LIMS1 Rabbit Polyclonal Antibody
TA358593

USD 360.00

5 Days

LIMS1 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated