Rabbit Polyclonal Anti-MAK Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAK antibody: synthetic peptide directed towards the C terminal of human MAK. Synthetic peptide located within the following region: WNTKTGRGQFSGRTYNPTAKNLNIVNRAQPIPSVHGRTDWVAKYGGHR |
Rabbit polyclonal MAK (Ab-159) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human MAK. |
Rabbit polyclonal MAK (Tyr159) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MAK around the phosphorylation site of tyrosine 159 (T-D-YP-V-S). |
| Modifications | Phospho-specific |
Carrier-free (BSA/glycerol-free) MAK mouse monoclonal antibody, clone OTI4H4 (formerly 4H4)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MAK mouse monoclonal antibody, clone OTI5F1 (formerly 5F1)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MAK mouse monoclonal antibody,clone OTI5A11
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MAK mouse monoclonal antibody, clone OTI5A7
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
MAK mouse monoclonal antibody,clone OTI1G2
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
MAK mouse monoclonal antibody, clone OTI4H4 (formerly 4H4)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
MAK mouse monoclonal antibody, clone OTI4H4 (formerly 4H4), Biotinylated
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Biotin |
MAK mouse monoclonal antibody, clone OTI4H4 (formerly 4H4), HRP conjugated
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | HRP |
MAK mouse monoclonal antibody, clone OTI4H4 (formerly 4H4)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
MAK mouse monoclonal antibody, clone OTI5F1 (formerly 5F1)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
MAK mouse monoclonal antibody, clone OTI5F1 (formerly 5F1), Biotinylated
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Biotin |
MAK mouse monoclonal antibody, clone OTI5F1 (formerly 5F1), HRP conjugated
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | HRP |
MAK mouse monoclonal antibody, clone OTI5F1 (formerly 5F1)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
MAK mouse monoclonal antibody,clone OTI5A11
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
MAK mouse monoclonal antibody,clone OTI5A11, Biotinylated
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Biotin |
MAK mouse monoclonal antibody,clone OTI5A11, HRP conjugated
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | HRP |
MAK mouse monoclonal antibody,clone OTI5A11
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
MAK mouse monoclonal antibody,clone OTI5A7
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
MAK mouse monoclonal antibody,clone OTI5A7, Biotinylated
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Biotin |
MAK mouse monoclonal antibody,clone OTI5A7, HRP conjugated
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | HRP |
MAK mouse monoclonal antibody,clone OTI5A7
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
MAK mouse monoclonal antibody,clone OTI5A7
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Germany
Japan
United Kingdom
China
