Trypsin (PRSS1) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | Synthetic peptide - KLH conjugated - corresponding to the central region (between 81-107 aa) of human Trypsin-1 / PRSS1. |
Trypsin (PRSS1) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | Synthetic peptide - KLH conjugated - corresponding to the central region (between 81-107 aa) of human Trypsin-1 / PRSS1. |
Anti-PRSS1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 24-247 amino acids of human protease, serine, 1 (trypsin 1) |
Rabbit Polyclonal Anti-PRSS1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PRSS1 antibody: synthetic peptide directed towards the N terminal of human PRSS1. Synthetic peptide located within the following region: LILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLIN |
PRSS1 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |