Rabbit Polyclonal Anti-PTH2R Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PTH2R antibody is: synthetic peptide directed towards the C-terminal region of Human PTH2R. Synthetic peptide located within the following region: NSEQDCLPHSFHEETKEDSGRQGDDILMEKPSRPMESNPDTEGCQGETED |
PTHR2 / PTH2R Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | PTHR2 / PTH2R antibody was raised against synthetic 20 amino acid peptide from 1st extracellular domain of human PTH2R / PTHR2. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (95%). |
PTHR2 / PTH2R Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | PTHR2 / PTH2R antibody was raised against synthetic 17 amino acid peptide from C-terminus of human PTH2R / PTHR2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (94%); Marmoset (88%); Bovine, Panda (82%). |
Germany
Japan
United Kingdom
China
