Antibodies

Jump to Filters
View as table Download
RAB14
AB0014-200

USD 300.00

In Stock

Goat Polyclonal Anti-Rab14 Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 110 aa to the C-terminus of mouse Rab14 produced in E. coli.
RAB14
AB0013-200

USD 300.00

In Stock

Goat Polyclonal Anti-Rab14 Antibody

Applications WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 110 aa to the C-terminus of mouse Rab14 produced in E. coli.
RAB14 Rabbit Polyclonal Antibody
TA330015

USD 375.00

5 Days

Rabbit Polyclonal Anti-RAB14 Antibody

Applications IHC, WB
Reactivities Human, Murin
Conjugation Unconjugated
Immunogen The immunogen for anti-RAB14 antibody: synthetic peptide directed towards the C terminal of human RAB14. Synthetic peptide located within the following region: FLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCG
RAB14 Rabbit Polyclonal Antibody
TA351570

USD 345.00

In Stock

Rabbit Polyclonal Anti-RAB14 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human RAB14