Rabbit Polyclonal Anti-SUPT16H Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SUPT16H antibody: synthetic peptide directed towards the middle region of human SUPT16H. Synthetic peptide located within the following region: EESDYSKESLGSEEESGKDWDELEEEARKADRESRYEEEEEQSRSMSRKR |
Rabbit Polyclonal Anti-SUPT16H Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SUPT16H Antibody: A synthesized peptide derived from human SUPT16H |
Goat Polyclonal Antibody against SUPT16H
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DLTNKEGKKPEEK, from the internal region of the protein sequence according to NP_009123.1. |
Rabbit Polyclonal anti-SUPT16H antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SUPT16H antibody: synthetic peptide directed towards the N terminal of human SUPT16H. Synthetic peptide located within the following region: ASKKKVEFLKQIANTKGNENANGAPAITLLIREKNESNKSSFDKMIEAIK |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Germany
Japan
United Kingdom
China
