Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-ZMY11 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ZMY11. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-ZMYND11 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZMYND11 antibody: synthetic peptide directed towards the middle region of human ZMYND11. Synthetic peptide located within the following region: SMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKV |
Rabbit Polyclonal Anti-ZMYND11 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZMYND11 antibody: synthetic peptide directed towards the N terminal of human ZMYND11. Synthetic peptide located within the following region: KKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNT |
BS69 (ZMYND11) (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human ZMYND11 |
Active filters
Target Symbol
- ZMYND11
Families
- Druggable Genome