Antibodies

View as table Download

Rabbit Polyclonal Anti-CCR2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CCR2 antibody: synthetic peptide directed towards the middle region of human CCR2. Synthetic peptide located within the following region: LIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILL

Rabbit Polyclonal CCR2 Antibody

Applications ELISA, WB
Reactivities Human
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Special Offer: Get a 15% discount on this product. Use code: "KO15".

Rabbit Polyclonal CCR2 Antibody

Applications FC
Reactivities Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide made to an N-terminal portion of the mouse CCR2 protein (within residues 20-100). [Swiss-Prot# P51683]

Rabbit Polyclonal Anti-CCR2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CCR2