Rabbit Polyclonal Anti-OR51E2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR51E2 antibody is: synthetic peptide directed towards the C-terminal region of Human OR51E2. Synthetic peptide located within the following region: VRVVMGDIYLLLPPVINPIIYGAKTKQIRTRVLAMFKISCDKDLQAVGGK |
Rabbit Polyclonal Anti-OR51E2 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | OR51E2 / PSGR antibody was raised against synthetic 14 amino acid peptide from N-terminal extracellular domain of human OR51E2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Galago, Marmoset, Hamster, Bat, Rabbit, Pig (100%); Mouse, Rat, Elephant, Panda, Bovine (93%); Horse (86%). |
OR51E1 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human |
| Immunogen | OR51E1 antibody was raised against synthetic 17 amino acid peptide from internal region of human OR51E1. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey (94%); Marmoset, Mouse, Hamster, Rabbit (88%); Gibbon, Galago, Rat (82%). |
Rabbit polyclonal anti-OR51E1 antibody (C-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This OR51E1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 280-309 amino acids from the C-terminal region of human OR51E1. |
OR52I2 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 312-341 amino acids from the C-terminal region of human OR52I2 |
OR52L1 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 299-329 amino acids from the C-terminal region of human OR52L1 |
Rabbit polyclonal anti-OR2A42 antibody
| Applications | IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human OR2A42. |
Rabbit Polyclonal anti-OR13C5 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR13C5 antibody: synthetic peptide directed towards the middle region of human OR13C5. Synthetic peptide located within the following region: CGTIFLMYMKPKSQETLNSDDLDATDKLIFIFYRVMTPMMNPLIYSLRNK |
Rabbit Polyclonal Anti-OR13C5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR13C5 antibody: synthetic peptide directed towards the N terminal of human OR13C5. Synthetic peptide located within the following region: CYTTTSIPSTLVSFLSERKTISLSGCAVQMFLSLAMGTTECVLLGVMAFD |
Rabbit Polyclonal Anti-OR13C5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR13C5 antibody is: synthetic peptide directed towards the N-terminal region of Human OR13C5. Synthetic peptide located within the following region: ILISILDPHLHTPMYFFLGNLSFLDICYTTTSIPSTLVSFLSERKTISLS |
Rabbit Polyclonal Anti-OR52I2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR52I2 Antibody is: synthetic peptide directed towards the N-terminal region of Human OR52I2. Synthetic peptide located within the following region: SSVVPKMVSIFCSGDSSISFSACFTQMFFVHLATAVETGLLLTMAFDRYV |
Rabbit Polyclonal Anti-OR13C5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR13C5 Antibody: synthetic peptide directed towards the N terminal of human OR13C5. Synthetic peptide located within the following region: ICYTTTSIPSTLVSFLSERKTISLSGCAVQMFLSLAMGTTECVLLGVMAF |
Rabbit Polyclonal Anti-OR2A42 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR2A42 antibody is: synthetic peptide directed towards the C-terminal region of Human OR2A42. Synthetic peptide located within the following region: FGSAIIMYMAPKSRHPEEQQKVFFLFYSFFNPTLNPLIYSLRNGEVKGAL |
Rabbit Polyclonal Anti-OR51E1 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | OR51E1 antibody was raised against synthetic 19 amino acid peptide from C-terminus of human OR51E1. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey (95%); Gibbon, Galago (89%); Marmoset, Panda (84%). |
Rabbit Polyclonal Anti-OR51E1 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | OR51E1 antibody was raised against synthetic 16 amino acid peptide from internal region of human OR51E1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Hamster, Panda, Rabbit, Horse, Pig (100%); Galago, Bat, Elephant (94%); Opossum (88%). |
Rabbit Polyclonal Anti-OR2C1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR2C1 antibody: synthetic peptide directed towards the C terminal of human OR2C1. Synthetic peptide located within the following region: FYGSASYGYLLPAKNSKQDQGKFISLFYSLVTPMVNPLIYTLRNMEVKGA |
Rabbit Polyclonal Anti-OR2D3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR2D3 antibody: synthetic peptide directed towards the C terminal of human OR2D3. Synthetic peptide located within the following region: LKAFSTCGSHLIVVVLFYGSGIFTYMRPNSKTTKELDKMISVFYTAVTPM |
Germany
Japan
United Kingdom
China
