USD 345.00
In Stock
Rabbit polyclonal anti-GIPR antibody
Applications | IF, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GIPR. |
USD 345.00
In Stock
Rabbit polyclonal anti-GIPR antibody
Applications | IF, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GIPR. |
USD 450.00
5 Days
Rabbit polyclonal GIPR Antibody (N-term)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This GIPR antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 7-38 amino acids from the N-terminal region of human GIPR. |
USD 375.00
5 Days
Rabbit Polyclonal Anti-GIPR Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GIPR antibody is: synthetic peptide directed towards the N-terminal region of Human GIPR. Synthetic peptide located within the following region: LRLSLCGLLLQRAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSVAA |
USD 345.00
In Stock
Rabbit Polyclonal Anti-GIPR Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GIPR |
USD 360.00
5 Days
GIPR Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |