Rabbit Polyclonal antibody to alpha 1a Adrenergic Receptor (adrenergic, alpha-1A-, receptor)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 206 and 260 of alpha 1a Adrenergic Receptor (Uniprot ID#P35348) |
alpha 1a Adrenergic Receptor (ADRA1A) rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Monkey, Mouse, Rabbit, Rat |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 206 and 270 of Human Alpha-1A adrenergic receptor |
Rabbit Polyclonal Anti-alpha1A-Adrenoceptor (extracellular)
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide EDETI*SQINEEPG(C), corresponding to amino acid residues 171-183 of human a1A adrenoceptor with replacement of cysteine 176 (C176) with serine. 2nd extracellular loop. |
Rabbit Polyclonal Anti-ADRA1A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADRA1A antibody is: synthetic peptide directed towards the C-terminal region of Human ADRA1A. Synthetic peptide located within the following region: LKSGLKTDKSDSEQVTLRIHRKNAPAGGSGMASAKTKTHFSVRLLKFSRE |
Anti-ADRA1A Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 152-165 amino acids of human adrenoceptor alpha 1A |
Germany
Japan
United Kingdom
China
