Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-GPR15 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | BOB / GPR15 antibody was raised against synthetic 19 amino acid peptide from C-terminus of human GPR15. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Elephant, Pig (100%); Marmoset, Hamster (95%); Panda, Bat, Dog, Bovine, Rabbit, Horse (89%). |
Rabbit Polyclonal GPR15 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | GPR15 antibody was raised against a peptide corresponding to amino acids near the amino terminus of human GPR15. The sequence differs from those of African green monkey and pig-tailed macaque BOB by one amino acid (2). |
Rabbit Polyclonal Anti-GPR15 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPR15 antibody: synthetic peptide directed towards the N terminal of human GPR15. Synthetic peptide located within the following region: FIINLAASDFIFLVTLPLWVDKEASLGLWRTGSFLCKGSSYMISVNMHCS |
Active filters
Target Symbol
- GPR15
Families
- GPCR