Antibodies

View as table Download

Rabbit polyclonal anti-GPR15 antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GPR15.

Rabbit Polyclonal Anti-GPR15 Antibody (C-Terminus)

Applications IHC
Reactivities Human
Immunogen BOB / GPR15 antibody was raised against synthetic 19 amino acid peptide from C-terminus of human GPR15. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Elephant, Pig (100%); Marmoset, Hamster (95%); Panda, Bat, Dog, Bovine, Rabbit, Horse (89%).

Rabbit Polyclonal GPR15 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen GPR15 antibody was raised against a peptide corresponding to amino acids near the amino terminus of human GPR15. The sequence differs from those of African green monkey and pig-tailed macaque BOB by one amino acid (2).

Rabbit Polyclonal Anti-GPR15 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPR15 antibody: synthetic peptide directed towards the N terminal of human GPR15. Synthetic peptide located within the following region: FIINLAASDFIFLVTLPLWVDKEASLGLWRTGSFLCKGSSYMISVNMHCS

Rabbit Polyclonal Anti-GPR15 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GPR15