Antibodies

View as table Download

Rabbit polyclonal anti-GPR142 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GPR142.

GPR142 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 93-122 amino acids from the N-terminal region of human GPR142

Goat Anti-GPR142 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DMWRDTDSPRTLD, from the internal region of the protein sequence according to NP_861455.1.

Rabbit Polyclonal Anti-GPR142 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GPR142 antibody is: synthetic peptide directed towards the N-terminal region of Human GPR142. Synthetic peptide located within the following region: IMMLPMEQKIQWVPTSLQDITAVLGTEAYTEEDKSMVSHAQKSQHSCLSH