Antibodies

View as table Download

Rabbit Polyclonal CCR2 Antibody

Applications FC, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide made to an N-terminal portion of the human CCR2 protein (within residues 20-100). [Swiss-Prot# P00338]

Rabbit Polyclonal Anti-CCR2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CCR2 antibody: synthetic peptide directed towards the middle region of human CCR2. Synthetic peptide located within the following region: LIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILL

Rabbit Polyclonal Anti-CCR2 Antibody (N-Terminus)

Applications IHC
Reactivities Tested: Human
Immunogen CCR2 antibody was raised against synthetic 20 amino acid peptide from N-terminal extracellular domain of human CCR2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%).

Rabbit Polyclonal CCR2 Antibody

Applications ELISA, WB
Reactivities Human
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Rabbit Polyclonal CCR2 Antibody

Applications FC
Reactivities Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide made to an N-terminal portion of the mouse CCR2 protein (within residues 20-100). [Swiss-Prot# P51683]

Rabbit Polyclonal Anti-CCR2 Antibody (Extracellular Domain)

Applications IHC
Reactivities Tested: Human; Predicted: Monkey
Immunogen CCR2 antibody was raised against synthetic 20 amino acid peptide from 2nd extracellular domain of human CCR2. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon (95%); Monkey (90%).

Rabbit Polyclonal Anti-CCR2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CCR2

CCR2 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated