Antibodies

View as table Download

GPCR150 (GPR160) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 309-338aa) from of human GPR160/GPCR150.

Rabbit Polyclonal Anti-GPR160 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GPR160 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR160. Synthetic peptide located within the following region: FSSHSSYTVRSKKIFLSKLIVCFLSTWLPFVLLQVIIVLLKVQIPAYIEM

Rabbit Polyclonal Anti-GPR160 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GPR160 antibody is: synthetic peptide directed towards the N-terminal region of Human GPR160. Synthetic peptide located within the following region: ILTLGMRRKNTCQNFMEYFCISLAFVDLLLLVNISIILYFRDFVLLSIRF