Antibodies

Jump to Filters
View as table Download
CNGA4 (N-term) Rabbit Polyclonal Antibody
AP50984PU-N

USD 450.00

2 Weeks

CNGA4 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 138-168 amino acids from the N-terminal region of human CNGA4
CNGA4 Rabbit Polyclonal Antibody
TA336009

USD 375.00

5 Days

Rabbit Polyclonal Anti-CNGA4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CNGA4 Antibody is: synthetic peptide directed towards the N-terminal region of Human CNGA4. Synthetic peptide located within the following region: RIAKLMLYIFVVIHWNSCLYFALSRYLGFGRDAWVYPDPAQPGFERLRRQ
CNG3 (CNGA3) Rabbit Polyclonal Antibody
TA323330

USD 345.00

4 Weeks

Anti-CNGA3 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 482-605 amino acids of human cyclic nucleotide gated channel alpha 3