CNGA4 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 138-168 amino acids from the N-terminal region of human CNGA4 |
CNGA4 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 138-168 amino acids from the N-terminal region of human CNGA4 |
Rabbit Polyclonal Anti-CNGA4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CNGA4 Antibody is: synthetic peptide directed towards the N-terminal region of Human CNGA4. Synthetic peptide located within the following region: RIAKLMLYIFVVIHWNSCLYFALSRYLGFGRDAWVYPDPAQPGFERLRRQ |
Anti-CNGA3 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 482-605 amino acids of human cyclic nucleotide gated channel alpha 3 |