Rabbit Polyclonal Anti-HTR3B Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HTR3B antibody: synthetic peptide directed towards the N terminal of human HTR3B. Synthetic peptide located within the following region: PLWACILVAAGILATDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKAT |
Goat Anti-Serotonin Receptor 3B / HTR3B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SNYLQTQDQTDQQE, from the internal region (near C-terminus) of the protein sequence according to NP_006019.1. |
Rabbit Polyclonal Anti-HTR3B Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human HTR3B |
Germany
Japan
United Kingdom
China
