Rabbit Polyclonal Anti-TOMM40L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TOMM40L antibody: synthetic peptide directed towards the middle region of human TOMM40L. Synthetic peptide located within the following region: LNAQVLLLLAERLRAKAVFQTQQAKFLTWQFDGEYRGDDYTATLTLGNPD |
Goat Anti-TOMM40 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HTVALSTIGESNYH, from the internal region of the protein sequence according to NP_006105.1. |
Rabbit polyclonal anti-Tom 40 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 339 of human TOM40 |
Rabbit Polyclonal Anti-TOMM40L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TOMM40L antibody: synthetic peptide directed towards the middle region of human TOMM40L. Synthetic peptide located within the following region: GGAHASYYHRANEQVQVGVEFEANTRLQDTTFSFGYHLTLPQANMVFRGL |
Carrier-free (BSA/glycerol-free) TOMM40L mouse monoclonal antibody,clone OTI5B1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TOMM40L mouse monoclonal antibody,clone OTI5D9
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TOMM40L mouse monoclonal antibody,clone OTI6F3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
TOMM40L mouse monoclonal antibody,clone OTI5B1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
TOMM40L mouse monoclonal antibody,clone OTI5B1, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
TOMM40L mouse monoclonal antibody,clone OTI5B1, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
TOMM40L mouse monoclonal antibody,clone OTI5B1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
TOMM40L mouse monoclonal antibody,clone OTI5D9
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
TOMM40L mouse monoclonal antibody,clone OTI5D9, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
TOMM40L mouse monoclonal antibody,clone OTI5D9, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
TOMM40L mouse monoclonal antibody,clone OTI5D9
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
TOMM40L mouse monoclonal antibody,clone OTI6F3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
TOMM40L mouse monoclonal antibody,clone OTI6F3, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
TOMM40L mouse monoclonal antibody,clone OTI6F3, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
TOMM40L mouse monoclonal antibody,clone OTI6F3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
2 Weeks
TOMM40 mouse monoclonal antibody,clone OTI9A3
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Germany
Japan
United Kingdom
China
