CACNG4 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 154-183 amino acids from the Central region of human CACNG4 |
CACNG4 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 154-183 amino acids from the Central region of human CACNG4 |
Rabbit polyclonal Anti-CACNG4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CACNG4 antibody: synthetic peptide directed towards the N terminal of human CACNG4. Synthetic peptide located within the following region: GPPPRRARGDLTHSGLWRVCCIEGIYKGHCFRINHFPEDNDYDHDSSEYL |
Rabbit Polyclonal Anti-CACNG4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CACNG4 antibody: synthetic peptide directed towards the N terminal of human CACNG4. Synthetic peptide located within the following region: GPPPRRARGDLTHSGLWRVCCIEGIYKGHCFRINHFPEDNDYDHDSSEYL |