Rabbit Polyclonal antibody to CTDSP2 (CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 2)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 26 and 271 of CTDSP2 (Uniprot ID#O14595) |
Rabbit Polyclonal Anti-CTDSP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTDSP2 antibody: synthetic peptide directed towards the N terminal of human CTDSP2. Synthetic peptide located within the following region: MEHGSIITQARREDALVLTKQGLVSKSSPKKPRGRNIFKALFCCFRAQHV |
Rabbit Polyclonal Anti-CTDSP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTDSP2 antibody: synthetic peptide directed towards the middle region of human CTDSP2. Synthetic peptide located within the following region: ASYIFHPENAVPVQSWFDDMADTELLNLIPIFEELSGAEDVYTSLGQLRA |
USD 420.00
4 Weeks
CTDSP2 mouse monoclonal antibody, clone OTI7F5 (formerly 7F5)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
CTDSP2 mouse monoclonal antibody, clone OTI10G10 (formerly 10G10)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Germany
Japan
United Kingdom
China
