Antibodies

View as table Download

Rabbit Polyclonal Presenilin1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Presenilin1 antibody was raised against a 23 amino acid peptide from near the carboxy terminus of human presenilin1.

Rabbit polyclonal anti-MMP-7 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human MMP-7.

Rabbit anti-MMP7 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MMP7

Rabbit polyclonal Presenilin 1 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human presenilin 1.

Rabbit Polyclonal Anti-MMP7 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-MMP7 Antibody: A synthesized peptide derived from human MMP7

Rabbit Polyclonal Anti-Presenilin 1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Presenilin 1 Antibody: A synthesized peptide derived from human Presenilin 1

Goat Polyclonal Antibody against MMP7

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QKLYGKRSNSRKK, from the C Terminus of the protein sequence according to NP_002414.1.

Rabbit Polyclonal antibody to SENP2 (SUMO1/sentrin/SMT3 specific peptidase 2)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1 and 62 of SENP2 (Uniprot ID#Q9HC62)

Rabbit polyclonal anti-SENP2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human SENP2.

Rabbit Polyclonal Anti-PSEN1 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PSEN1 antibody: synthetic peptide directed towards the N terminal of human PSEN1. Synthetic peptide located within the following region: TRKDGQLIYTPFTEDTETVGQRALHSILNAAIMISVIVVMTILLVVLYKY

Rabbit Polyclonal Anti-MMP7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MMP7 antibody: synthetic peptide directed towards the C terminal of human MMP7. Synthetic peptide located within the following region: AATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGK

Rabbit anti Presenillin Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated

Rabbit anti MMP-7 (Matrilysin) Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the C-terminus of human MMP-7. This sequence is identical among bovine and monkey.

Anti-MMP7 Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 5-100 amino acids of human matrix metallopeptidase 7 (matrilysin, uterine)

Rabbit Polyclonal Anti-SENP2 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human SENP2