Antibodies

Jump to Filters
View as table Download
CAPNS1 Rabbit Polyclonal Antibody
TA344345

USD 475.00

5 Days

Rabbit Polyclonal Anti-CAPNS1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CAPNS1 antibody: synthetic peptide directed towards the middle region of human CAPNS1. Synthetic peptide located within the following region: RRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQL
CAPNS1 Rabbit Polyclonal Antibody
TA323499

USD 345.00

In Stock

Anti-CAPNS1 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 91-268 amino acids of human calpain, small subunit 1
CAPNS1 Rabbit Polyclonal Antibody
TA323500

USD 345.00

In Stock

Anti-CAPNS1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 91-268 amino acids of human calpain, small subunit 1