Antibodies

Jump to Filters
View as table Download
GFPT2 Rabbit Polyclonal Antibody
TA346394

USD 475.00

5 Days

Rabbit Polyclonal Anti-GFPT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GFPT2 antibody: synthetic peptide directed towards the N terminal of human GFPT2. Synthetic peptide located within the following region: DLRKFLESKGYEFESETDTETIAKLIKYVFDNRETEDITFSTLVERVIQQ
GFPT2 Rabbit Polyclonal Antibody
TA346395

USD 475.00

5 Days

Rabbit Polyclonal Anti-GFPT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GFPT2 antibody: synthetic peptide directed towards the middle region of human GFPT2. Synthetic peptide located within the following region: TARQGRPIILCSKDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFH
GFPT2 (Center) Rabbit Polyclonal Antibody
AP51823PU-N

USD 450.00

2 Weeks

GFPT2 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 181~210 amino acids from the Center region of human GFPT2 / GFAT2
GFPT1 Rabbit Polyclonal Antibody
TA341276

USD 425.00

2 Weeks

Rabbit Polyclonal Anti-GFPT1 Antibody (N-Terminus)

Applications IHC
Reactivities Human
Immunogen GFPT1 / GFAT antibody was raised against synthetic 12 amino acid peptide from N-Terminus of human GFPT1. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Elephant, Panda, Bovine, Dog, Bat, Horse, Pig, Opossum, Guinea pig, Zebra finch, Chicken (100%); Turkey, Platypus (92%).
GFPT1 Rabbit Polyclonal Antibody
TA341277

USD 425.00

5 Days

Rabbit Polyclonal Anti-GFPT1 Antibody (C-Terminus)

Applications IHC
Reactivities Human
Immunogen GFPT1 / GFAT antibody was raised against synthetic 14 amino acid peptide from C-Terminus of human GFPT1. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Elephant, Bovine, Horse, Pig, Opossum, Guinea pig (100%); Dog, Bat (93%); Turkey, Zebra finch, Chicken (86%).
Phosphoribosyl pyrophosphate amidotransferase (PPAT) Mouse Monoclonal Antibody [Clone ID: OTI3C6]
CF504457

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PPAT mouse monoclonal antibody, clone OTI3C6 (formerly 3C6)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Phosphoribosyl pyrophosphate amidotransferase (PPAT) Mouse Monoclonal Antibody [Clone ID: OTI2C2]
CF504463

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PPAT mouse monoclonal antibody, clone OTI2C2 (formerly 2C2)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Phosphoribosyl pyrophosphate amidotransferase (PPAT) Mouse Monoclonal Antibody [Clone ID: OTI1D9]
CF504508

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PPAT mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Phosphoribosyl pyrophosphate amidotransferase (PPAT) Mouse Monoclonal Antibody [Clone ID: OTI1B2]
CF504559

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PPAT mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)

Applications FC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Phosphoribosyl pyrophosphate amidotransferase (PPAT) Mouse Monoclonal Antibody [Clone ID: OTI1B11]
CF504706

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PPAT mouse monoclonal antibody, clone OTI1B11 (formerly 1B11)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Phosphoribosyl pyrophosphate amidotransferase (PPAT) Mouse Monoclonal Antibody [Clone ID: OTI1B8]
CF504769

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PPAT mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated
Phosphoribosyl pyrophosphate amidotransferase (PPAT) Rabbit Polyclonal Antibody
TA350023

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-PPAT Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PPAT
Phosphoribosyl pyrophosphate amidotransferase (PPAT) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3C6]
TA504457AM

USD 420.00

4 Weeks

PPAT mouse monoclonal antibody, clone OTI3C6 (formerly 3C6), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
Phosphoribosyl pyrophosphate amidotransferase (PPAT) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3C6]
TA504457BM

USD 420.00

4 Weeks

PPAT mouse monoclonal antibody, clone OTI3C6 (formerly 3C6), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP
Phosphoribosyl pyrophosphate amidotransferase (PPAT) Mouse Monoclonal Antibody [Clone ID: OTI3C6]
TA504457S

USD 159.00

2 Days

PPAT mouse monoclonal antibody, clone OTI3C6 (formerly 3C6)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Phosphoribosyl pyrophosphate amidotransferase (PPAT) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2C2]
TA504463AM

USD 420.00

4 Weeks

PPAT mouse monoclonal antibody, clone OTI2C2 (formerly 2C2), Biotinylated

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
Phosphoribosyl pyrophosphate amidotransferase (PPAT) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2C2]
TA504463BM

USD 420.00

4 Weeks

PPAT mouse monoclonal antibody, clone OTI2C2 (formerly 2C2), HRP conjugated

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP
Phosphoribosyl pyrophosphate amidotransferase (PPAT) Mouse Monoclonal Antibody [Clone ID: OTI2C2]
TA504463S

USD 159.00

2 Days

PPAT mouse monoclonal antibody, clone OTI2C2 (formerly 2C2)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Phosphoribosyl pyrophosphate amidotransferase (PPAT) Mouse Monoclonal Antibody [Clone ID: OTI1C7]
TA504481S

USD 159.00

2 Days

PPAT mouse monoclonal antibody, clone OTI1C7 (formerly 1C7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Phosphoribosyl pyrophosphate amidotransferase (PPAT) Mouse Monoclonal Antibody [Clone ID: OTI1E1]
TA504496S

USD 159.00

2 Days

PPAT mouse monoclonal antibody, clone OTI1E1 (formerly 1E1)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Phosphoribosyl pyrophosphate amidotransferase (PPAT) Mouse Monoclonal Antibody [Clone ID: OTI1C2]
TA504497S

USD 159.00

2 Days

PPAT mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Phosphoribosyl pyrophosphate amidotransferase (PPAT) Mouse Monoclonal Antibody [Clone ID: OTI1C4]
TA504498S

USD 159.00

2 Days

PPAT mouse monoclonal antibody, clone OTI1C4 (formerly 1C4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Phosphoribosyl pyrophosphate amidotransferase (PPAT) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D9]
TA504508AM

USD 420.00

4 Weeks

PPAT mouse monoclonal antibody, clone OTI1D9 (formerly 1D9), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
Phosphoribosyl pyrophosphate amidotransferase (PPAT) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D9]
TA504508BM

USD 420.00

4 Weeks

PPAT mouse monoclonal antibody, clone OTI1D9 (formerly 1D9), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP
Phosphoribosyl pyrophosphate amidotransferase (PPAT) Mouse Monoclonal Antibody [Clone ID: OTI1D9]
TA504508S

USD 159.00

2 Days

PPAT mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Phosphoribosyl pyrophosphate amidotransferase (PPAT) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B2]
TA504559AM

USD 420.00

4 Weeks

PPAT mouse monoclonal antibody, clone OTI1B2 (formerly 1B2), Biotinylated

Applications FC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Biotin
Phosphoribosyl pyrophosphate amidotransferase (PPAT) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B2]
TA504559BM

USD 420.00

4 Weeks

PPAT mouse monoclonal antibody, clone OTI1B2 (formerly 1B2), HRP conjugated

Applications FC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation HRP
Phosphoribosyl pyrophosphate amidotransferase (PPAT) Mouse Monoclonal Antibody [Clone ID: OTI1B2]
TA504559S

USD 159.00

2 Days

PPAT mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)

Applications FC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Phosphoribosyl pyrophosphate amidotransferase (PPAT) Mouse Monoclonal Antibody [Clone ID: OTI1B11]
TA504706

USD 379.00

In Stock

PPAT mouse monoclonal antibody, clone OTI1B11 (formerly 1B11)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Phosphoribosyl pyrophosphate amidotransferase (PPAT) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B11]
TA504706AM

USD 420.00

5 Days

PPAT mouse monoclonal antibody,clone 1B11, Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin