Antibodies

View as table Download

Rabbit Polyclonal Anti-Rnpep Antibody - C-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Rnpep antibody is: synthetic peptide directed towards the C-terminal region of Mouse Rnpep. Synthetic peptide located within the following region: TCLEAATGRALLRQHMNVSGEENPLNKLRVKIEPGVDPDDTYNETPYEKG

Carrier-free (BSA/glycerol-free) RNPEP mouse monoclonal antibody, clone OTI3B5 (formerly 3B5)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) RNPEP mouse monoclonal antibody, clone OTI2G3 (formerly 2G3)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) RNPEP mouse monoclonal antibody, clone OTI1B1 (formerly 1B1)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RNPEP mouse monoclonal antibody, clone OTI3B5 (formerly 3B5)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RNPEP mouse monoclonal antibody, clone OTI3B5 (formerly 3B5), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

RNPEP mouse monoclonal antibody, clone OTI3B5 (formerly 3B5), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

RNPEP mouse monoclonal antibody, clone OTI3B5 (formerly 3B5)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

RNPEP mouse monoclonal antibody, clone OTI2G3 (formerly 2G3)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RNPEP mouse monoclonal antibody, clone OTI2G3 (formerly 2G3), Biotinylated

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

RNPEP mouse monoclonal antibody, clone OTI2G3 (formerly 2G3), HRP conjugated

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

RNPEP mouse monoclonal antibody, clone OTI2G3 (formerly 2G3)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

RNPEP mouse monoclonal antibody, clone OTI1B1 (formerly 1B1)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RNPEP mouse monoclonal antibody, clone OTI1B1 (formerly 1B1)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".