Rabbit Polyclonal Anti-XPNPEP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-XPNPEP2 antibody: synthetic peptide directed towards the middle region of human XPNPEP2. Synthetic peptide located within the following region: QALLKASHVRDAVAVIRYLVWLEKNVPKGTVDEFSGAEIVDKFRGEEQFS |
Rabbit polyclonal antibody to XPNPEP2 (X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-bound)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 286 and 564 of XPNPEP2 (Uniprot ID#O43895) |
Rabbit polyclonal antibody to XPNPEP2 (X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-bound)
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 198 and 476 of XPNPEP2 (Uniprot ID#O43895) |
Germany
Japan
United Kingdom
China